TB-500 Peptide: What It Is and What Research Actually Shows
Recovery protocolsOctober 7, 202611 min read
TB-500 isn't just another name for Thymosin Beta-4 — most vendor pages treat it that way. What research actually supports, and how it compares to BPC-157.
TB-500 is a short synthetic fragment of Thymosin Beta-4 (Ac-LKKTETQ-OH, residues 17–23) — not simply another name for the full 43-amino-acid protein.
The strongest human clinical evidence in this space (a Phase 2 dry-eye trial) belongs to the full-length protein delivered topically, not the injectable research fragment sold as TB-500.
TB-500 and BPC-157 are unrelated molecules with separate, mostly preclinical evidence bases; no study has tested them combined as a blend.
TB-500 is one of the most searched research peptides, and also one of the most mislabeled. Vendor pages routinely describe it as simply "Thymosin Beta-4," as if the two names referred to one identical molecule. They don't. Getting that distinction right is the difference between citing real clinical research and citing the wrong one.
Featured In This Article
RESEARCH PEPTIDE
TB-500
Highly purified synthetic peptide prepared for rigorous laboratory research.
$65.00
RESEARCH PEPTIDE
BPC-157 / TB-500 Blend
Highly purified synthetic peptide prepared for rigorous laboratory research.
$109.00
TB-500 is a synthetic peptide, commonly supplied as a short acetylated fragment, corresponding to an active region of Thymosin Beta-4 (Tβ4) — a naturally occurring 43-amino-acid protein. The full-length protein has an actual human clinical research record. The short commercial fragment sold under the name "TB-500" largely does not, at least not directly.
What follows is a research-first breakdown: what TB-500 actually is at the molecular level, what the evidence shows (and for which molecule), how it compares to BPC-157, what "research use only" and regulatory status mean here, how to read a certificate of analysis, and why this page won't give you a dosing schedule.
What Is TB-500?
TB-500 is a synthetic 7-amino-acid fragment (Ac-LKKTETQ-OH) of Thymosin Beta-4, a 43-amino-acid protein naturally found in human and animal cells. It is not the full protein — just a small piece of it, sold under a separate commercial name. Tβ4's full sequence is SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES.
According to reference data from Cayman Chemical, a life-science reagent supplier, the material sold as "TB-500" corresponds to Ac-LKKTETQ-OH — residues 17–23 of Tβ4, an acetylated 7-amino-acid fragment covering the region commonly referred to as Tβ4's “actin-binding motif.” That is a specific, checkable claim, not a simplification for marketing purposes — and it's the detail most TB-500 content skips entirely.
In plain terms: TB-500 is not “another name” for Thymosin Beta-4. It is a short synthetic piece of it. That distinction matters for every claim that follows.
TB-500 and Thymosin Beta-4: Are They the Same Molecule?
No — not in the way most vendor pages imply. This is the single most-confused terminology issue in TB-500 content, and it's worth being precise about it.
Structural research on Tβ4 adds an important wrinkle here. A crystal-structure study published in The EMBO Journal (Irobi et al., 2004) resolved how Tβ4 binds actin and found that essentially the entire Tβ4 sequence — not just the short “actin-binding motif” — contacts the actin monomer during sequestration. That means the 7-residue fragment sold as TB-500 captures only part of the structural interaction the full protein makes; whether it reproduces Tβ4's functional activity is a separate question research doesn't fully settle for the fragment alone.
The two molecules also have very different human-evidence records. Full-length Tβ4, under the name RGN-259, was tested in a randomized, double-masked, placebo-controlled Phase 2 trial for severe dry eye disease (Sosne, Dunn & Kim, Cornea, 2015), which reported statistically significant improvements in both symptoms and corneal staining compared to vehicle control. That is real human clinical data — for the full 43-amino-acid protein, delivered as eye drops, not for the short injectable research fragment marketed as TB-500.
There's also a regulatory wrinkle worth flagging precisely because it cuts the other way: the World Anti-Doping Agency's 2026 Prohibited List, as described by Sport Integrity Australia, lists Thymosin Beta-4 under S2.3 (Growth Factors and Growth Factor Modulators) and treats “TB-500” and “TB4” as alternative names for the same prohibited substance — it does not distinguish the commercial fragment from the full-length protein for anti-doping purposes. A sports regulator's equivalence standard is not a molecular-biology equivalence standard; both are accurate within their own context, and conflating them is exactly the kind of imprecision this section exists to avoid.
Bottom line for research purposes: TB-500 is derived from, and corresponds to an active region of, Thymosin Beta-4 — it is not simply “the same thing.” Citing full-length Tβ4's clinical research to support claims about the commercial TB-500 fragment is citing evidence for a different, if related, molecule.
What the Research Actually Shows
Research relevant to TB-500/Tβ4 spans several very different contexts. Grading it honestly means keeping those contexts separate rather than citing the strongest available evidence as if it applied everywhere. In preclinical models, the TB-500 fragment itself is most often studied for its association with cell migration and angiogenesis — not for the broader tissue-repair claims sometimes made about it, which belong to the full-length protein or remain unestablished for the fragment specifically.
Reduced ocular discomfort and corneal staining versus vehicle in severe dry eye (Sosne et al., 2015)
Does not establish efficacy for injectable use, tissue repair outside the eye, or for the short TB-500 fragment specifically
Tβ4 actin-binding mechanism
Structural / X-ray crystallography (cell-free)
Describes how Tβ4 physically binds and sequesters actin monomers (Irobi et al., 2004)
A mechanistic/structural finding, not a clinical outcome; doesn't by itself establish what the isolated 7-residue fragment does in a living organism
TB-500 fragment (Ac-LKKTETQ-OH), cell migration / angiogenesis
Preclinical (cellular and animal models), widely cited in vendor and research-blog literature
Associated with actin regulation and cell-migration research in in-vitro and animal models
Direct, controlled human trials specifically on this short fragment are not established in the record reviewed for this article — treat as a research gap, not a settled negative
The honest summary: the strongest human clinical evidence in this space belongs to the full-length protein in a topical/ophthalmic context, not to the injectable fragment research-chemical vendors sell as “TB-500.” Treat any claim that doesn't specify which molecule and which route it's describing with caution.
TB-500 vs. BPC-157
TB-500 and BPC-157 are frequently searched and sold together, including as a combined blend, but they are unrelated molecules with different origins, mechanisms, and evidence bases. For a full breakdown of BPC-157's own research record, see the BPC-157 explainer; the comparison here stays at the level needed to avoid conflating the two.
Property
TB-500 (Tβ4 fragment)
BPC-157
Identity
Synthetic fragment (Ac-LKKTETQ-OH) of a naturally occurring human protein, Thymosin Beta-4
Synthetic pentadecapeptide; derived from a fragment sequence studied in gastric-protective research
Primary research context
Cell migration, actin regulation, angiogenesis (cellular/animal models); full-length protein has human ophthalmic trial data
Tissue-repair signaling across tendon, muscle, gut, and skin-wound animal models; large preclinical literature, thin human record
Human clinical evidence
Yes, for the full-length protein in a topical/ophthalmic context (RGN-259 dry-eye trial); not established for the short fragment
No randomized controlled trial in humans as of this writing; a retrospective knee-pain case series and small pilots exist
Listed under WADA's Prohibited List as a non-approved substance (S0)
Research-use-only status
Sold as RUO; not FDA-approved for human or animal use
Sold as RUO; not FDA-approved for human or animal use
Neither peptide is “better” than the other in any evidence-supported sense — they have different research histories and are not interchangeable. Claims framing one as superior to the other aren't supported by a head-to-head trial, because none exists.
Safety and Research Considerations
Safety data specific to the TB-500 fragment, delivered by injection, in humans, is limited. The full-length protein's ophthalmic trial (Sosne et al., 2015) reported it as safe and well-tolerated in that specific context — topical eye-drop administration, not an injectable research fragment. That finding does not transfer automatically to a different molecule delivered by a different route.
No systematic human safety review of the commercial TB-500 fragment specifically was located for this article. Where evidence doesn't exist, the honest position is to say so rather than reassure or alarm readers with claims the literature doesn't support.
Research Use and Regulatory Context
TB-500 is sold strictly for laboratory and research use (RUO). It has not been evaluated by the FDA and is not approved, intended, or labeled for human or animal consumption. An RUO designation describes how a product is marketed; it is not itself a statement about legality, which depends on jurisdiction, intended use, and how a product is actually used or represented.
BPC-157 was reviewed by the FDA's Pharmacy Compounding Advisory Committee (PCAC) in 2026, which voted to recommend adding it to the bulk drug substances list for compounding pharmacies, while reviewers also raised concerns about limited human clinical evidence for its safety and effectiveness. TB-500 was separately under PCAC review for wound-healing use at the same proceedings; the specific outcome of that review should be checked against the FDA's current public record before publishing, as committee recommendations are updated over time.
On the anti-doping side, Thymosin Beta-4 — including TB-500 as an alternative name for the same WADA-listed entry — appears under S2.3 (Growth Factors and Growth Factor Modulators) on the World Anti-Doping Agency's 2026 Prohibited List, per Sport Integrity Australia. That means TB-500 is banned in competitive sport regardless of its evidence status or how the commercial product is labeled.
How to Read a TB-500 Certificate of Analysis
A certificate of analysis (COA) is the primary way to verify what's actually in a vial — and, given the molecular-identity issue above, it's especially important for TB-500 specifically.
1. The lot number matches the vial. A certificate that doesn't reference your specific batch isn't documentation for your product.
2. Identity and purity are different questions. Mass spectrometry (or similar) supports identity confirmation — that the molecule present is what's claimed. HPLC-assessed purity means unwanted material falls below a threshold under that method. A purity percentage alone says nothing about identity.
3. For TB-500 specifically, identity confirmation should specify the fragment. Given that “TB-500” covers material that could, in principle, be marketed inconsistently across vendors, a COA that confirms the specific sequence (ideally Ac-LKKTETQ-OH) is stronger documentation than one that simply names the product.
4. The testing lab must be verifiable. A COA is only as credible as the lab that produced it. If the lab can't be verified independently, the certificate is an unverifiable document.
One line worth holding onto: a clean COA confirms what's in the vial. It doesn't establish safety, efficacy, or that the material should be used at all.
TB-500 at Certified Aminos
Certified Aminos lists TB-500 in 5MG and 10MG sizes under its Healing & Recovery category, with purity reported at ≥99% (HPLC certified) and testing described as third-party independent analysis with full traceability via COA. As with any RUO listing, verify the current lot's COA and stock availability on the product page before relying on any figure stated here, and treat this paragraph as a pointer to that documentation rather than a restatement of it.
Certified Aminos also carries a combined BPC-157/TB-500 Blend for researchers investigating both peptides together; as the comparison section above notes, no study has tested the combination itself, so the blend's existence is a sourcing convenience, not evidence of synergy.
Why This Article Won't Give You a Dosing Schedule
TB-500 dosage queries make up a real share of search demand around this topic. This page won't answer them with numbers, but here's what can be said safely.
The milligram amount on a vial label describes total peptide content — the manufacturer's quantity statement. It is not a recommended dose and not a dosing unit.
Reconstitution (mixing lyophilized powder with a sterile liquid before use) is a standard handling step for peptide research materials generally. This article won't cover volumes, ratios, or injection steps, because those are protocol decisions that belong outside a product explainer and outside what online content should be providing at all.
What this page will never do: no dosing numbers, no unit math, no reconstitution ratios, no injection schedules, no administration steps. TB-500 is sold strictly for laboratory and research use. It has not been evaluated by the FDA and is not intended for human or animal consumption. Any personal-use decision belongs with a licensed clinician, not a product explainer.
Three Things Worth Holding Onto
TB-500 is a name for a short synthetic fragment of Thymosin Beta-4, not a synonym for the full protein — and the strongest human clinical evidence in this space belongs to the full-length molecule in a topical context, not the injectable research fragment. Treat any source that uses the two names interchangeably with extra scrutiny.
For the related compounds mentioned throughout this piece, see the BPC-157 explainer and the BPC-157/TB-500 Blend product page. To verify current lot documentation for any Certified Aminos product, check the COA link on that product's own page.
For research use only. Not for human or veterinary use.
Got Questions?
Frequently Asked Questions
TB-500 is the common research/commercial name for a synthetic peptide fragment derived from Thymosin Beta-4 (Tβ4), a naturally occurring 43-amino-acid protein. Reference data from Cayman Chemical identifies the material as Ac-LKKTETQ-OH, corresponding to residues 17–23 of Tβ4.
