LL-37 is Certified Aminos' research listing for the 37-amino-acid, C-terminal active fragment of human cathelicidin (hCAP18), one of the most extensively studied antimicrobial peptides in the human genome. Available in 1mg for laboratory research use only.
HPLC certified
Independent analysis
Highest standard
Full traceability
Each order ships as an LL-37 research peptide in a 1mg vial, manufactured for laboratory use only.
| Product Name | LL-37 (Human Cathelicidin LL-37 Fragment) |
|---|---|
| Peptide Identity | C-terminal active fragment of human cathelicidin precursor hCAP18 |
| Sequence | [LL-37, 37 aa] (37 residues) -- cross-checked against supplier chemical-database listings; not independently confirmed via a public chemical database (ChEMBL has no entry under "LL-37" or "cathelicidin") or this batch's own COA |
| Molecular Formula / MW | C205H340N60O53, ~4493.6 g/mol -- same sourcing caveat as above |
| CAS Number | 154947-66-7 -- same sourcing caveat as above |
| Available Size | 1mg |
| Purity | Not independently verified -- no batch-specific COA is currently published |
| Identity | Not independently confirmed by mass spectrometry or an equivalent method |
| Intended Use | Laboratory research only (RUO) |
When your order arrives, match the lot number printed on the vial to the lot number on the COA before beginning any work. Until a batch-specific COA is published for this product, treat any purity or identity figure shown elsewhere on this listing as a supplier claim, not an independently verified result.
LL-37 is the only cathelicidin peptide humans make. Here's what controlled human trials actually found — and where the evidence for antimicrobial and immune claims stops.
HCG and LH bind the exact same receptor — yet research shows they send measurably different signals once they do. Here's what's actually established about HCG's structure, mechanism, and the FDA's position on HCG weight-loss claims.
No peer-reviewed human study of IGF-1 LR3 exists — a 2026 literature review placed it in its lowest evidence tier. Here's what the cell and animal research actually shows, and where it stops.
